PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10028662m
Common NameCICLE_v10028658mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 379aa    MW: 41634.8 Da    PI: 6.4142
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10028662mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.96.4e-30156209155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Ciclev10028662m 156 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 209
                      59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.061153212IPR017930Myb domain
SuperFamilySSF466891.97E-19153213IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-30155214IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-23157209IPR006447Myb domain, plants
PfamPF002497.1E-8159208IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MGEEVRMTEY EVNDKGDYNG DDERIPEWEM GLPNGTDLTP LSQSLIPPEL ASAFSILPVP  60
CRTHLDVNRA SQTTLSSIRG SRAHSLSSTD NNNSNNLKTL TENRDPMVTE TEEQDQNGSF  120
ADSRSKSRRP DCTEEADSAL RTDNSNEDPS ARTLKRPRLV WTPQLHKRFV DVVAHLGIKN  180
AVPKTIMQLM NVEGLTRENV ASHLQKYRLY LKRMQGLSND DPSSSDHQLF ASTPVPPQCL  240
PYESTNGGPH VGHLCNSNNN NNNGSINNNN NNNDGNSNNG SGNSGHVGMA AYGAPAGMMT  300
APMYGMINHQ GFHHGHGFDP SMYNMNMNMG MGMNMNMGMN NMMHQQRDWS VNKHGYGHGH  360
GQGSVVSYPQ HVAPSSDK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-20155214463ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006424879.10.0hypothetical protein CICLE_v10028658mg
RefseqXP_006424880.10.0hypothetical protein CICLE_v10028658mg
RefseqXP_006424881.10.0hypothetical protein CICLE_v10028658mg
RefseqXP_006488371.10.0PREDICTED: transcription factor LUX
SwissprotQ9SNB42e-85PCL1_ARATH; Transcription factor LUX
TrEMBLV4SH300.0V4SH30_9R
STRINGVIT_06s0004g05120.t011e-106(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.21e-82G2-like family protein